SCOP 1.73: Domain d2gz2b2: 2gz2 B:128-329

Lineage for d2gz2b2 (2gz2 B:128-329)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [143538] (4 PDB entries)

8. Domain d2gz2b2: 2gz2 B:128-329 [135894]
   Other proteins in same PDB: d2gz2a1, d2gz2b1
   automatically matched to 2GYY A:128-329
   complexed with a2p

Details for d2gz2b2

PDB Entry: 2gz2, 2.1 Å

PDB Description: structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp

PDB Compounds: (B:) Aspartate beta-semialdehyde dehydrogenase

SCOP Domain Sequences for d2gz2b2:

Sequence; same for both SEQRES and ATOM records:

>d2gz2b2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

Timeline for d2gz2b2:

• d2gz2b2 is new in SCOP 1.73
  
• d2gz2b2 appears in SCOP 1.75
  
• d2gz2b2 appears in the current release, SCOPe 2.08