Lineage for d2gz2b2 (2gz2 B:128-329)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961618Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 2961649Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (18 PDB entries)
    Uniprot Q8DQ00 128-329
  8. 2961669Domain d2gz2b2: 2gz2 B:128-329 [135894]
    Other proteins in same PDB: d2gz2a1, d2gz2b1
    automated match to d2gyya2
    complexed with a2p

Details for d2gz2b2

PDB Entry: 2gz2 (more details), 2.1 Å

PDB Description: structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp
PDB Compounds: (B:) Aspartate beta-semialdehyde dehydrogenase

SCOPe Domain Sequences for d2gz2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gz2b2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOPe Domain Coordinates for d2gz2b2:

Click to download the PDB-style file with coordinates for d2gz2b2.
(The format of our PDB-style files is described here.)

Timeline for d2gz2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gz2b1