![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [141917] (4 PDB entries) |
![]() | Domain d2gz1b1: 2gz1 B:2-127,B:330-357 [135889] Other proteins in same PDB: d2gz1a2, d2gz1b2 automatically matched to 2GYY A:2-127,A:330-357 complexed with nap |
PDB Entry: 2gz1 (more details), 1.8 Å
SCOP Domain Sequences for d2gz1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gz1b1 c.2.1.3 (B:2-127,B:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng iiacpnXaawnsvqiaetlherglvrptaelkfel
Timeline for d2gz1b1: