Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
Species Streptococcus pneumoniae [TaxId:1313] [141917] (4 PDB entries) |
Domain d2gz1a1: 2gz1 A:2-127,A:330-357 [135887] Other proteins in same PDB: d2gz1a2, d2gz1b2 automatically matched to 2GYY A:2-127,A:330-357 complexed with nap |
PDB Entry: 2gz1 (more details), 1.8 Å
SCOP Domain Sequences for d2gz1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng iiacpnXaawnsvqiaetlherglvrptaelkfel
Timeline for d2gz1a1: