Lineage for d2gz1a1 (2gz1 A:2-127,A:330-357)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687270Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 687301Species Streptococcus pneumoniae [TaxId:1313] [141917] (4 PDB entries)
  8. 687302Domain d2gz1a1: 2gz1 A:2-127,A:330-357 [135887]
    Other proteins in same PDB: d2gz1a2, d2gz1b2
    automatically matched to 2GYY A:2-127,A:330-357
    complexed with nap

Details for d2gz1a1

PDB Entry: 2gz1 (more details), 1.8 Å

PDB Description: Structure of Aspartate Semialdehyde Dehydrogenase (ASADH) from Streptococcus pneumoniae complexed with NADP
PDB Compounds: (A:) Aspartate beta-semialdehyde dehydrogenase

SCOP Domain Sequences for d2gz1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfel

SCOP Domain Coordinates for d2gz1a1:

Click to download the PDB-style file with coordinates for d2gz1a1.
(The format of our PDB-style files is described here.)

Timeline for d2gz1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gz1a2