Lineage for d2gyyd2 (2gyy D:128-329)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (18 PDB entries)
    Uniprot Q8DQ00 128-329
  8. Domain d2gyyd2: 2gyy D:128-329 [135886]
    Other proteins in same PDB: d2gyya1, d2gyyb1, d2gyyc1, d2gyyd1
    automated match to d2gyya2

Details for d2gyyd2

PDB Entry: 2gyy (more details), 2.1 Å

PDB Description: Structure of aspartate semialdehyde dehydrogenase (ASADH) from Streptococcus pneumoniae
PDB Compounds: (D:) Aspartate beta-semialdehyde dehydrogenase

SCOPe Domain Sequences for d2gyyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyyd2 d.81.1.1 (D:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOPe Domain Coordinates for d2gyyd2 are not available.

Timeline for d2gyyd2:

Domains from same chain:
(mouse over for more information)
d2gyyd1
Domains from other chains:
(mouse over for more information)
d2gyya1, d2gyya2, d2gyyb1, d2gyyb2, d2gyyc1, d2gyyc2