Lineage for d2gyyc2 (2gyy C:128-329)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866362Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 866363Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 866370Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 866401Species Streptococcus pneumoniae [TaxId:1313] [143538] (4 PDB entries)
    Uniprot Q8DQ00 128-329
  8. 866406Domain d2gyyc2: 2gyy C:128-329 [135884]
    Other proteins in same PDB: d2gyya1, d2gyyb1, d2gyyc1, d2gyyd1
    automatically matched to 2GYY A:128-329

Details for d2gyyc2

PDB Entry: 2gyy (more details), 2.1 Å

PDB Description: Structure of aspartate semialdehyde dehydrogenase (ASADH) from Streptococcus pneumoniae
PDB Compounds: (C:) Aspartate beta-semialdehyde dehydrogenase

SCOP Domain Sequences for d2gyyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyyc2 d.81.1.1 (C:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOP Domain Coordinates for d2gyyc2:

Click to download the PDB-style file with coordinates for d2gyyc2.
(The format of our PDB-style files is described here.)

Timeline for d2gyyc2: