Lineage for d2gyya1 (2gyy A:2-127,A:330-357)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 820760Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 820803Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 820834Species Streptococcus pneumoniae [TaxId:1313] [141917] (4 PDB entries)
    Uniprot Q8DQ00 2-127,330-357
  8. 820837Domain d2gyya1: 2gyy A:2-127,A:330-357 [135879]
    Other proteins in same PDB: d2gyya2, d2gyyb2, d2gyyc2, d2gyyd2

Details for d2gyya1

PDB Entry: 2gyy (more details), 2.1 Å

PDB Description: Structure of aspartate semialdehyde dehydrogenase (ASADH) from Streptococcus pneumoniae
PDB Compounds: (A:) Aspartate beta-semialdehyde dehydrogenase

SCOP Domain Sequences for d2gyya1:

Sequence, based on SEQRES records: (download)

>d2gyya1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfel

Sequence, based on observed residues (ATOM records): (download)

>d2gyya1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasgkslkfkdqditieettetafegv
dialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahngiiac
pnXaawnsvqiaetlherglvrptaelkfel

SCOP Domain Coordinates for d2gyya1:

Click to download the PDB-style file with coordinates for d2gyya1.
(The format of our PDB-style files is described here.)

Timeline for d2gyya1: