Lineage for d2gysb4 (2gys B:317-416)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935738Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 935739Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries)
  8. 935747Domain d2gysb4: 2gys B:317-416 [135872]
    automatically matched to d1gh7a4

Details for d2gysb4

PDB Entry: 2gys (more details), 2.7 Å

PDB Description: 2.7 a structure of the extracellular domains of the human beta common receptor involved in il-3, il-5, and gm-csf signalling
PDB Compounds: (B:) cytokine receptor common beta chain

SCOPe Domain Sequences for d2gysb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gysb4 b.1.2.1 (B:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna
hsmalpalepstrywarvrvrtsrtgyngiwsewsearsw

SCOPe Domain Coordinates for d2gysb4:

Click to download the PDB-style file with coordinates for d2gysb4.
(The format of our PDB-style files is described here.)

Timeline for d2gysb4: