Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species) duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3 |
Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries) |
Domain d2gysb4: 2gys B:317-416 [135872] automatically matched to d1gh7a4 complexed with bma, fuc, nag, ndg; mutant |
PDB Entry: 2gys (more details), 2.7 Å
SCOP Domain Sequences for d2gysb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gysb4 b.1.2.1 (B:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna hsmalpalepstrywarvrvrtsrtgyngiwsewsearsw
Timeline for d2gysb4:
View in 3D Domains from other chains: (mouse over for more information) d2gysa1, d2gysa2, d2gysa3, d2gysa4 |