Lineage for d2gysb1 (2gys B:1-103)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657202Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 657203Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries)
  8. 657208Domain d2gysb1: 2gys B:1-103 [135869]
    automatically matched to d1gh7a1
    complexed with bma, fuc, nag, ndg; mutant

Details for d2gysb1

PDB Entry: 2gys (more details), 2.7 Å

PDB Description: 2.7 a structure of the extracellular domains of the human beta common receptor involved in il-3, il-5, and gm-csf signalling
PDB Compounds: (B:) cytokine receptor common beta chain

SCOP Domain Sequences for d2gysb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gysb1 b.1.2.1 (B:1-103) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtl

SCOP Domain Coordinates for d2gysb1:

Click to download the PDB-style file with coordinates for d2gysb1.
(The format of our PDB-style files is described here.)

Timeline for d2gysb1: