SCOPe 2.07: Domain d2gyqb_: 2gyq B:

Lineage for d2gyqb_ (2gyq B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.4: YciF-like [140445] (3 proteins)
   Pfam PF05974; DUF892

6. Protein Hypothetical ptotein RPA3308 [140446] (1 species)
   putative structural protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [140447] (1 PDB entry)
   Uniprot Q6N4M9 1-160

8. Domain d2gyqb_: 2gyq B: [135864]
   automated match to d2gyqa1
   complexed with act, edo, fe, na, zn

Details for d2gyqb_

PDB Entry: 2gyq, 1.4 Å

PDB Description: YcfI, a putative structural protein from Rhodopseudomonas palustris.

PDB Compounds: (B:) ycfI, putative structural protein

SCOPe Domain Sequences for d2gyqb_:

Sequence; same for both SEQRES and ATOM records:

>d2gyqb_ a.25.1.4 (B:) Hypothetical ptotein RPA3308 {Rhodopseudomonas palustris [TaxId: 1076]}
ffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqier
ldqvfkklgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiaryg
tliawaeelghddivrflttnlneekaantklntval

Timeline for d2gyqb_:

• d2gyqb_ first appeared in SCOP 1.73, called d2gyqb1
  
• d2gyqb_ appears in SCOPe 2.06
  
• d2gyqb_ appears in the current release, SCOPe 2.08