SCOPe 2.06: Domain d2gyob2: 2gyo B:175-317

Lineage for d2gyob2 (2gyo B:175-317)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (4 species)

7. Species Escherichia coli [TaxId:562] [53913] (13 PDB entries)

8. Domain d2gyob2: 2gyo B:175-317 [135862]
   automated match to d1hnja2
   complexed with coa, mee, so4

Details for d2gyob2

PDB Entry: 2gyo, 2 Å

PDB Description: Methanethiol-Cys 112 Inhibition Complex of E. Coli Ketoacyl Synthase III (FabH) and Coenzyme A

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2gyob2:

Sequence; same for both SEQRES and ATOM records:

>d2gyob2 c.95.1.2 (B:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

Timeline for d2gyob2:

• d2gyob2 first appeared in SCOP 1.73
  
• d2gyob2 appears in SCOPe 2.05
  
• d2gyob2 appears in SCOPe 2.07
  
• d2gyob2 appears in the current release, SCOPe 2.08