![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L15 (L15p) [52082] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [141994] (9 PDB entries) |
![]() | Domain d2gycj1: 2gyc J:4-143 [135850] Other proteins in same PDB: d2gyc11, d2gyc31, d2gyc32, d2gyc51, d2gyc52, d2gyck1, d2gycn1, d2gycs1, d2gyct1, d2gycw1 automatically matched to 2AW4 L:1-144 |
PDB Entry: 2gyc (more details), 2 Å
SCOP Domain Sequences for d2gycj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gycj1 c.12.1.1 (J:4-143) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} ntlspaegskkagkrlgrgigsglgktggrghkgqksrsgggvrrgfeggqmplyrrlpk fgftsrkaaitaeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpvtvr glrvtkgaraaieaaggkie
Timeline for d2gycj1: