Lineage for d2gyc31 (2gyc 3:2-48)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775032Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 775033Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 775034Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 775035Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 775036Species Escherichia coli [TaxId:562] [101379] (5 PDB entries)
  8. 775037Domain d2gyc31: 2gyc 3:2-48 [135846]
    Other proteins in same PDB: d2gyc11, d2gyc32, d2gyc52, d2gycb1, d2gycc1, d2gycd1, d2gycf1, d2gycf2, d2gycg1, d2gycg2, d2gych1, d2gyci1, d2gycj1, d2gyck1, d2gycm1, d2gycn1, d2gyco1, d2gycq1, d2gycs1, d2gyct1, d2gycu1, d2gycw1, d2gycx1
    automatically matched to d1rqua1

Details for d2gyc31

PDB Entry: 2gyc (more details), 2 Å

PDB Description: Structure of the 50S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (3:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d2gyc31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
itkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaa

SCOP Domain Coordinates for d2gyc31:

Click to download the PDB-style file with coordinates for d2gyc31.
(The format of our PDB-style files is described here.)

Timeline for d2gyc31: