Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Escherichia coli [TaxId:562] [111186] (9 PDB entries) Uniprot P02361 |
Domain d2gybh1: 2gyb H:3-128 [135844] Other proteins in same PDB: d2gybb1, d2gybd1, d2gybi1, d2gybm1, d2gybp1, d2gybq1, d2gybs1, d2gybt1 automatically matched to d1s03h_ |
PDB Entry: 2gyb (more details), 2 Å
SCOP Domain Sequences for d2gybh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gybh1 d.140.1.1 (H:3-128) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg eiicyv
Timeline for d2gybh1: