Class b: All beta proteins [48724] (165 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein L25 [50717] (1 species) |
Species Escherichia coli [TaxId:562] [50718] (12 PDB entries) |
Domain d2gyat1: 2gya T:1-94 [135842] Other proteins in same PDB: d2gya11, d2gya31, d2gya32, d2gya51, d2gya52, d2gyaj1, d2gyak1, d2gyan1, d2gyas1, d2gyaw1 automatically matched to d1b75a_ |
PDB Entry: 2gya (more details), 2 Å
SCOP Domain Sequences for d2gyat1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gyat1 b.53.1.1 (T:1-94) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d2gyat1: