![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
![]() | Protein Ribosomal protein L19 [141246] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [141247] (9 PDB entries) Uniprot P0A7K6 1-114 |
![]() | Domain d2gyan1: 2gya N:1-114 [135840] Other proteins in same PDB: d2gya11, d2gya31, d2gya32, d2gya51, d2gya52, d2gyab1, d2gyac1, d2gyad1, d2gyaf1, d2gyaf2, d2gyag1, d2gyag2, d2gyah1, d2gyai1, d2gyaj1, d2gyak1, d2gyam1, d2gyao1, d2gyaq1, d2gyas1, d2gyat1, d2gyau1, d2gyaw1, d2gyax1 automatically matched to 2AW4 P:1-114 |
PDB Entry: 2gya (more details), 15 Å
SCOPe Domain Sequences for d2gyan1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gyan1 b.34.5.6 (N:1-114) Ribosomal protein L19 {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d2gyan1: