Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L15 (L15p) [52082] (4 species) |
Species Escherichia coli [TaxId:562] [141994] (29 PDB entries) Uniprot P02413 1-144 |
Domain d2gyaj1: 2gya J:4-143 [135838] Other proteins in same PDB: d2gya11, d2gya31, d2gya32, d2gya51, d2gya52, d2gyab1, d2gyac1, d2gyad1, d2gyaf1, d2gyaf2, d2gyag1, d2gyag2, d2gyah1, d2gyai1, d2gyak1, d2gyam1, d2gyan1, d2gyao1, d2gyaq1, d2gyas1, d2gyat1, d2gyau1, d2gyaw1, d2gyax1 |
PDB Entry: 2gya (more details), 15 Å
SCOPe Domain Sequences for d2gyaj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gyaj1 c.12.1.1 (J:4-143) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} ntlspaegskkagkrlgrgigsglgktggrghkgqksrsgggvrrgfeggqmplyrrlpk fgftsrkaaitaeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpvtvr glrvtkgaraaieaaggkie
Timeline for d2gyaj1: