| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily) multihelical; intertwined tetramer |
Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) ![]() |
| Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein) |
| Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species) |
| Species Escherichia coli [TaxId:562] [101379] (5 PDB entries) |
| Domain d2gya51: 2gya 5:2-48 [135836] Other proteins in same PDB: d2gya11, d2gya32, d2gya52, d2gyaj1, d2gyak1, d2gyan1, d2gyas1, d2gyat1, d2gyaw1 automatically matched to d1rqua1 |
PDB Entry: 2gya (more details), 2 Å
SCOP Domain Sequences for d2gya51:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gya51 a.108.1.1 (5:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
itkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaa
Timeline for d2gya51: