![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
![]() | Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() automatically mapped to Pfam PF00410 |
![]() | Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
![]() | Protein Ribosomal protein S8 [56049] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [111186] (9 PDB entries) Uniprot P02361 |
![]() | Domain d2gy9h1: 2gy9 H:3-128 [135832] Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1 |
PDB Entry: 2gy9 (more details), 15 Å
SCOPe Domain Sequences for d2gy9h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gy9h1 d.140.1.1 (H:3-128) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg eiicyv
Timeline for d2gy9h1: