Lineage for d2gy9h1 (2gy9 H:3-128)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041534Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1041535Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 1041536Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1041537Protein Ribosomal protein S8 [56049] (4 species)
  7. 1041541Species Escherichia coli [TaxId:562] [111186] (9 PDB entries)
    Uniprot P02361
  8. 1041550Domain d2gy9h1: 2gy9 H:3-128 [135832]
    Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1
    automatically matched to d1s03h_

Details for d2gy9h1

PDB Entry: 2gy9 (more details), 15 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (H:) 30S ribosomal subunit protein S8

SCOPe Domain Sequences for d2gy9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9h1 d.140.1.1 (H:3-128) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyv

SCOPe Domain Coordinates for d2gy9h1:

Click to download the PDB-style file with coordinates for d2gy9h1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9h1: