Lineage for d2gx9a1 (2gx9 A:79-205)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882202Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 882203Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
  5. 882204Family d.299.1.1: Ns1 effector domain-like [143022] (1 protein)
    C-terminal part of Pfam PF00600
  6. 882205Protein Non-structural protein NS1 C-terminal domain [143023] (1 species)
  7. 882206Species Influenza A virus [TaxId:11320] [143024] (1 PDB entry)
    Uniprot Q71QT3 79-205
  8. 882207Domain d2gx9a1: 2gx9 A:79-205 [135828]
    complexed with scn

Details for d2gx9a1

PDB Entry: 2gx9 (more details), 2.1 Å

PDB Description: x-ray structure of influenza virus ns1 effector domain
PDB Compounds: (A:) NS1 Effector Domain

SCOP Domain Sequences for d2gx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gx9a1 d.299.1.1 (A:79-205) Non-structural protein NS1 C-terminal domain {Influenza A virus [TaxId: 11320]}
mtmasvpasryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvif
drletlillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetl
qrfawrs

SCOP Domain Coordinates for d2gx9a1:

Click to download the PDB-style file with coordinates for d2gx9a1.
(The format of our PDB-style files is described here.)

Timeline for d2gx9a1: