Lineage for d2gx8c_ (2gx8 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151827Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 2151828Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) (S)
    di-iron binding protein
  5. 2151829Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 protein domains)
    Pfam PF01784
  6. 2151849Protein Nif3-related protein BC4286 [142818] (1 species)
  7. 2151850Species Bacillus cereus [TaxId:1396] [142819] (1 PDB entry)
    Uniprot Q818H0 4-373
  8. 2151853Domain d2gx8c_: 2gx8 C: [135827]
    automated match to d2gx8a1
    complexed with epe, trs, zn

Details for d2gx8c_

PDB Entry: 2gx8 (more details), 2.2 Å

PDB Description: the crystal structure of bacillus cereus protein related to nif3
PDB Compounds: (C:) NIF3-related protein

SCOPe Domain Sequences for d2gx8c_:

Sequence, based on SEQRES records: (download)

>d2gx8c_ c.135.1.1 (C:) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]}
skipngheiislfesmypkhlamegdkiglqigalnkpvrhvlialdvteevvdeaiqlg
anviiahhplifnplkaihtdkaygkiiekcikndiaiyaahtnvdvakggvndllaeal
glqntevlaptyaeemkkvvvfvpvthaeevrkalgdagaghignyshctfssegtgtfv
pqegtnpyigetgqlerveevrietiipaslqrkvikamvtahpyeevaydvypldnkge
tlglgkigylqeemtlgqfaehvkqsldvkgarvvgklddkvrkvavlggdgnkyinqak
fkgadvyvtgdmyyhvahdammlglnivdpghnvekvmkqgvqkqlqekvdakklnvhih
asqlhtdpfifv

Sequence, based on observed residues (ATOM records): (download)

>d2gx8c_ c.135.1.1 (C:) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]}
skipngheiislfesmypkhlamegdkiglqigalnkpvrhvlialdvteevvdeaiqlg
anviiahhplifnplkaihtdkaygkiiekcikndiaiyaahtnvdvakggvndllaeal
glqntevlaptyaeemkkvvvfvpvthaeevrkalgdagaghignyshctfssegtgtfv
pqeggqlerveevrietiipaslqrkvikamvtahpyeevaydvypldnkgetlglgkig
ylqeemtlgqfaehvkqsldvkgarvvgklddkvrkvavlggdgnkyinqakfkgadvyv
tgdmyyhvahdammlglnivdpghnvekvmkqgvqkqlqekvdakklnvhihasqlhtdp
fifv

SCOPe Domain Coordinates for d2gx8c_:

Click to download the PDB-style file with coordinates for d2gx8c_.
(The format of our PDB-style files is described here.)

Timeline for d2gx8c_: