Lineage for d2gwsm1 (2gws M:250-327)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771080Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 771081Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 771205Protein DNA polymerase lambda [101251] (1 species)
  7. 771206Species Human (Homo sapiens) [TaxId:9606] [101252] (17 PDB entries)
  8. 771232Domain d2gwsm1: 2gws M:250-327 [135822]
    Other proteins in same PDB: d2gwsa2, d2gwsa3, d2gwse2, d2gwse3, d2gwsi2, d2gwsi3, d2gwsm2, d2gwsm3
    automatically matched to d1nzpa_
    complexed with cac, cl, edo, mg, na

Details for d2gwsm1

PDB Entry: 2gws (more details), 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus
PDB Compounds: (M:) DNA polymerase lambda

SCOP Domain Sequences for d2gwsm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwsm1 a.60.6.1 (M:250-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
aekiieilesghlrkldh

SCOP Domain Coordinates for d2gwsm1:

Click to download the PDB-style file with coordinates for d2gwsm1.
(The format of our PDB-style files is described here.)

Timeline for d2gwsm1: