Lineage for d2gwse3 (2gws E:386-575)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2612791Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2612969Protein DNA polymerase lambda [102943] (1 species)
  7. 2612970Species Human (Homo sapiens) [TaxId:9606] [102944] (27 PDB entries)
  8. 2613012Domain d2gwse3: 2gws E:386-575 [135818]
    Other proteins in same PDB: d2gwsa1, d2gwsa2, d2gwse1, d2gwse2, d2gwsi1, d2gwsi2, d2gwsm1, d2gwsm2
    automated match to d1rzta3
    protein/DNA complex; complexed with cac, cl, edo, mg, na

Details for d2gwse3

PDB Entry: 2gws (more details), 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus
PDB Compounds: (E:) DNA polymerase lambda

SCOPe Domain Sequences for d2gwse3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwse3 d.218.1.2 (E:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

SCOPe Domain Coordinates for d2gwse3:

Click to download the PDB-style file with coordinates for d2gwse3.
(The format of our PDB-style files is described here.)

Timeline for d2gwse3: