![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
![]() | Protein DNA polymerase lambda [101253] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries) |
![]() | Domain d2gwse2: 2gws E:329-385 [135817] Other proteins in same PDB: d2gwsa1, d2gwsa3, d2gwse1, d2gwse3, d2gwsi1, d2gwsi3, d2gwsm1, d2gwsm3 automated match to d2pfna2 protein/DNA complex; complexed with cac, cl, edo, mg, na |
PDB Entry: 2gws (more details), 2.4 Å
SCOPe Domain Sequences for d2gwse2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gwse2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d2gwse2: