| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
| Protein DNA polymerase lambda [101253] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101254] (16 PDB entries) |
| Domain d2gwsa2: 2gws A:329-385 [135814] Other proteins in same PDB: d2gwsa1, d2gwsa3, d2gwse1, d2gwse3, d2gwsi1, d2gwsi3, d2gwsm1, d2gwsm3 automatically matched to d1rzta2 complexed with cac, cl, edo, mg, na |
PDB Entry: 2gws (more details), 2.4 Å
SCOP Domain Sequences for d2gwsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gwsa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d2gwsa2: