Lineage for d2gwsa1 (2gws A:249-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716076Protein DNA polymerase lambda [101251] (1 species)
  7. 2716077Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2716118Domain d2gwsa1: 2gws A:249-328 [135813]
    Other proteins in same PDB: d2gwsa2, d2gwsa3, d2gwse2, d2gwse3, d2gwsi2, d2gwsi3, d2gwsm2, d2gwsm3
    automated match to d1rzta1
    protein/DNA complex; complexed with cac, cl, edo, mg, na

Details for d2gwsa1

PDB Entry: 2gws (more details), 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2gwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwsa1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d2gwsa1:

Click to download the PDB-style file with coordinates for d2gwsa1.
(The format of our PDB-style files is described here.)

Timeline for d2gwsa1: