![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (64 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (13 PDB entries) |
![]() | Domain d2gwkb1: 2gwk B:5-147 [135811] Other proteins in same PDB: d2gwka2, d2gwkb2 automated match to d1lcua1 complexed with atp, ca |
PDB Entry: 2gwk (more details), 2 Å
SCOPe Domain Sequences for d2gwkb1:
Sequence, based on SEQRES records: (download)
>d2gwkb1 c.55.1.0 (B:5-147) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf etfnvpamyvaiqavlslyasgr
>d2gwkb1 c.55.1.0 (B:5-147) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprhqgvmkdsyvgdeaqskrgiltlky piehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnv pamyvaiqavlslyasgr
Timeline for d2gwkb1: