Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries) |
Domain d2gwja2: 2gwj A:148-375 [135808] Other proteins in same PDB: d2gwja1 automated match to d1lcua2 complexed with atp, ca |
PDB Entry: 2gwj (more details), 1.9 Å
SCOPe Domain Sequences for d2gwja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gwja2 c.55.1.1 (A:148-375) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaere ivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfi gmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmki kiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf
Timeline for d2gwja2: