Lineage for d2gwga1 (2gwg A:1-342)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084845Family c.1.9.15: PP1699/LP2961-like [141819] (6 protein domains)
    Pfam PF04909; Amidohydrolase; stand-alone domain
  6. 2084868Protein 4-oxalomesaconate hydratase LigJ [141826] (1 species)
  7. 2084869Species Rhodopseudomonas palustris [TaxId:1076] [141827] (1 PDB entry)
    Uniprot Q6N0R4 1-342
  8. 2084870Domain d2gwga1: 2gwg A:1-342 [135805]
    Other proteins in same PDB: d2gwga2, d2gwgb3
    complexed with zn

Details for d2gwga1

PDB Entry: 2gwg (more details), 1.8 Å

PDB Description: crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
PDB Compounds: (A:) 4-oxalomesaconate hydratase

SCOPe Domain Sequences for d2gwga1:

Sequence, based on SEQRES records: (download)

>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]}
miidihghyttapkaledwrnrqiagikdpsvmpkvselkisddelqasiienqlkkmqe
rgsdltvfsprasfmahhigdfnvsstwaaicnelcyrvsqlfpdnfigaamlpqspgvd
pktcipelekcvkeygfvainlnpdpsgghwtsppltdriwypiyekmveleipamihvs
tscntcfhttgahylnadttafmqcvagdlfkdfpelkfviphgggavpyhwgrfrglaq
emkkplledhvlnniffdtcvyhqpgidllntvipvdnvlfasemigavrgidprtgfyy
ddtkryieastiltpeekqqiyegnarrvyprldaalkakgk

Sequence, based on observed residues (ATOM records): (download)

>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]}
miidihghyttapkaledwrnrqiagikdpsvmpkvselkisddelqasiienqlkkmqe
rgsdltvfspragdfnvsstwaaicnelcyrvsqlfpdnfigaamlpqspgvdpktcipe
lekcvkeygfvainlnpdpsgghwtsppltdriwypiyekmveleipamihvstgahyln
adttafmqcvagdlfkdfpelkfviphgggavpyhwgrfrglaqemkkplledhvlnnif
fdtcvyhqpgidllntvipvdnvlfasemigavrgidprtgfyyddtkryieastiltpe
ekqqiyegnarrvyprldaalkakgk

SCOPe Domain Coordinates for d2gwga1:

Click to download the PDB-style file with coordinates for d2gwga1.
(The format of our PDB-style files is described here.)

Timeline for d2gwga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gwga2