Lineage for d2gw9a_ (2gw9 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637642Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 2637643Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 2637644Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 2637714Protein Defensin-related cryptdin 4 [118245] (1 species)
  7. 2637715Species Mouse (Mus musculus) [TaxId:10090] [118246] (3 PDB entries)
    Uniprot P28311 61-92
  8. 2637716Domain d2gw9a_: 2gw9 A: [135801]
    automated match to d2gw9a1

Details for d2gw9a_

PDB Entry: 2gw9 (more details)

PDB Description: high-resolution solution structure of the mouse defensin cryptdin4
PDB Compounds: (A:) Defensin-related cryptdin 4

SCOPe Domain Sequences for d2gw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gw9a_ g.9.1.1 (A:) Defensin-related cryptdin 4 {Mouse (Mus musculus) [TaxId: 10090]}
gllcycrkghckrgervrgtcgirflyccprr

SCOPe Domain Coordinates for d2gw9a_:

Click to download the PDB-style file with coordinates for d2gw9a_.
(The format of our PDB-style files is described here.)

Timeline for d2gw9a_: