Lineage for d2gw9a1 (2gw9 A:1-32)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890710Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 890711Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 890712Family g.9.1.1: Defensin [57393] (10 proteins)
  6. 890780Protein Defensin-related cryptdin 4 [118245] (1 species)
  7. 890781Species Mouse (Mus musculus) [TaxId:10090] [118246] (2 PDB entries)
    Uniprot P28311 61-92
  8. 890783Domain d2gw9a1: 2gw9 A:1-32 [135801]
    automatically matched to d1tv0a_

Details for d2gw9a1

PDB Entry: 2gw9 (more details)

PDB Description: high-resolution solution structure of the mouse defensin cryptdin4
PDB Compounds: (A:) Defensin-related cryptdin 4

SCOP Domain Sequences for d2gw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gw9a1 g.9.1.1 (A:1-32) Defensin-related cryptdin 4 {Mouse (Mus musculus) [TaxId: 10090]}
gllcycrkghckrgervrgtcgirflyccprr

SCOP Domain Coordinates for d2gw9a1:

Click to download the PDB-style file with coordinates for d2gw9a1.
(The format of our PDB-style files is described here.)

Timeline for d2gw9a1: