SCOP 1.73: Domain d2gvzc2: 2gvz C:39-65,C:202-382

Lineage for d2gvzc2 (2gvz C:39-65,C:202-382)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (3 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries)

8. Domain d2gvzc2: 2gvz C:39-65,C:202-382 [135800]
   Other proteins in same PDB: d2gvza1, d2gvzb1, d2gvzc1
   automatically matched to d1azsc2
   complexed with cl, fkp, gsp, mn, ona

Details for d2gvzc2

PDB Entry: 2gvz, 3.27 Å

PDB Description: crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOP Domain Sequences for d2gvzc2:

Sequence; same for both SEQRES and ATOM records:

>d2gvzc2 c.37.1.8 (C:39-65,C:202-382) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdi

Timeline for d2gvzc2:

• d2gvzc2 is new in SCOP 1.73
  
• d2gvzc2 appears in SCOP 1.75
  
• d2gvzc2 appears in the current release, SCOPe 2.08