SCOPe 2.07: Domain d2gvzb1: 2gvz B:880-1076

Lineage for d2gvzb1 (2gvz B:880-1076)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Type II adenylyl cyclase C2 domain [55075] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55076] (9 PDB entries)
   Uniprot P26769 879-1077

8. Domain d2gvzb1: 2gvz B:880-1076 [135798]
   Other proteins in same PDB: d2gvza1, d2gvzc1, d2gvzc2
   automatically matched to d1ab8b_
   complexed with cl, fkp, gsp, mn, ona

Details for d2gvzb1

PDB Entry: 2gvz, 3.27 Å

PDB Description: crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn

PDB Compounds: (B:) Adenylate cyclase type 2

SCOPe Domain Sequences for d2gvzb1:

Sequence, based on SEQRES records:

>d2gvzb1 d.58.29.1 (B:880-1076) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekikt
igstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrvg
inhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcr
giinvkgkgdlktyfvn

Sequence, based on observed residues (ATOM records):

>d2gvzb1 d.58.29.1 (B:880-1076) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekikt
igstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
lktyfvn

Timeline for d2gvzb1:

• d2gvzb1 first appeared in SCOP 1.73
  
• d2gvzb1 appears in SCOPe 2.06
  
• d2gvzb1 appears in the current release, SCOPe 2.08