Lineage for d2gvzb1 (2gvz B:880-1076)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561636Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561637Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2561686Protein Type II adenylyl cyclase C2 domain [55075] (1 species)
  7. 2561687Species Norway rat (Rattus norvegicus) [TaxId:10116] [55076] (9 PDB entries)
    Uniprot P26769 879-1077
  8. 2561697Domain d2gvzb1: 2gvz B:880-1076 [135798]
    Other proteins in same PDB: d2gvza1, d2gvzc1, d2gvzc2
    automatically matched to d1ab8b_
    complexed with cl, fkp, gsp, mn, ona

Details for d2gvzb1

PDB Entry: 2gvz (more details), 3.27 Å

PDB Description: crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
PDB Compounds: (B:) Adenylate cyclase type 2

SCOPe Domain Sequences for d2gvzb1:

Sequence, based on SEQRES records: (download)

>d2gvzb1 d.58.29.1 (B:880-1076) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekikt
igstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrvg
inhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcr
giinvkgkgdlktyfvn

Sequence, based on observed residues (ATOM records): (download)

>d2gvzb1 d.58.29.1 (B:880-1076) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekikt
igstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
lktyfvn

SCOPe Domain Coordinates for d2gvzb1:

Click to download the PDB-style file with coordinates for d2gvzb1.
(The format of our PDB-style files is described here.)

Timeline for d2gvzb1: