SCOP 1.73: Domain d2gvza1: 2gvz A:377-565

Lineage for d2gvza1 (2gvz A:377-565)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (11 PDB entries)

8. Domain d2gvza1: 2gvz A:377-565 [135797]
   Other proteins in same PDB: d2gvzb1, d2gvzc1, d2gvzc2
   automatically matched to d1azsa_
   complexed with cl, fkp, gsp, mn, ona

Details for d2gvza1

PDB Entry: 2gvz, 3.27 Å

PDB Description: crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn

PDB Compounds: (A:) Adenylate cyclase type 5

SCOP Domain Sequences for d2gvza1:

Sequence; same for both SEQRES and ATOM records:

>d2gvza1 d.58.29.1 (A:377-565) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

Timeline for d2gvza1:

• d2gvza1 is new in SCOP 1.73
  
• d2gvza1 appears in SCOP 1.75
  
• d2gvza1 appears in the current release, SCOPe 2.08