Lineage for d2gvza1 (2gvz A:377-565)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954780Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2954808Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. 2954809Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries)
    Uniprot P30803 458-646
  8. 2954824Domain d2gvza1: 2gvz A:377-565 [135797]
    Other proteins in same PDB: d2gvzb1, d2gvzc1, d2gvzc2
    automatically matched to d1azsa_
    complexed with cl, fkp, gsp, mn, ona

Details for d2gvza1

PDB Entry: 2gvz (more details), 3.27 Å

PDB Description: crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
PDB Compounds: (A:) Adenylate cyclase type 5

SCOPe Domain Sequences for d2gvza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvza1 d.58.29.1 (A:377-565) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

SCOPe Domain Coordinates for d2gvza1:

Click to download the PDB-style file with coordinates for d2gvza1.
(The format of our PDB-style files is described here.)

Timeline for d2gvza1: