Lineage for d2gvyb2 (2gvy B:1-381)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682439Protein Fungal alpha-amylases [51462] (2 species)
  7. 682442Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (5 PDB entries)
  8. 682445Domain d2gvyb2: 2gvy B:1-381 [135796]
    Other proteins in same PDB: d2gvya1, d2gvyb1
    automatically matched to d6taa_2
    complexed with ca, glc, nag

Details for d2gvyb2

PDB Entry: 2gvy (more details), 1.8 Å

PDB Description: monoclinic crystal form of aspergillus niger alpha-amylase in complex with maltose at 1.8 a resolution
PDB Compounds: (B:) alpha-amylase A

SCOP Domain Sequences for d2gvyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvyb2 c.1.8.1 (B:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

SCOP Domain Coordinates for d2gvyb2:

Click to download the PDB-style file with coordinates for d2gvyb2.
(The format of our PDB-style files is described here.)

Timeline for d2gvyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gvyb1