SCOP 1.73: Domain d2gvyb1: 2gvy B:382-476

Lineage for d2gvyb1 (2gvy B:382-476)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Fungal alpha-amylase [51028] (2 species)

7. Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (5 PDB entries)

8. Domain d2gvyb1: 2gvy B:382-476 [135795]
   Other proteins in same PDB: d2gvya2, d2gvyb2
   automatically matched to d6taa_1
   complexed with ca, glc, nag

Details for d2gvyb1

PDB Entry: 2gvy, 1.8 Å

PDB Description: monoclinic crystal form of aspergillus niger alpha-amylase in complex with maltose at 1.8 a resolution

PDB Compounds: (B:) alpha-amylase A

SCOP Domain Sequences for d2gvyb1:

Sequence; same for both SEQRES and ATOM records:

>d2gvyb1 b.71.1.1 (B:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

Timeline for d2gvyb1:

• d2gvyb1 is new in SCOP 1.73
  
• d2gvyb1 appears in SCOP 1.75
  
• d2gvyb1 appears in the current release, SCOPe 2.08