![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) ![]() |
![]() | Family b.68.6.1: SGL-like [63830] (4 proteins) |
![]() | Protein Diisopropylfluorophosphatase (phosphotriesterase, DFP) [63831] (1 species) |
![]() | Species Squid (Loligo vulgaris) [TaxId:6622] [63832] (21 PDB entries) Uniprot Q7SIG4 |
![]() | Domain d2gvva_: 2gvv A: [135791] automated match to d1pjxa_ complexed with ca, di9 |
PDB Entry: 2gvv (more details), 1.73 Å
SCOPe Domain Sequences for d2gvva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvva_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} ipvieplftkvtedipgaegpvfdkngdfyivapevevngkpageilridlktgkktvic kpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcndc afdyegnlwitapagevapadytrsmqekfgsiycfttdgqmiqvdtafqfpngiavrhm ndgrpyqlivaetptkklwsydikgpakienkkvwghipgtheggadgmdfdednnllva nwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrngk kqycetlkf
Timeline for d2gvva_: