Class a: All alpha proteins [46456] (290 folds) |
Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) automatically mapped to Pfam PF02885 |
Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [81775] (7 PDB entries) |
Domain d2gvqc1: 2gvq C:1-70 [135787] Other proteins in same PDB: d2gvqa2, d2gvqb2, d2gvqc2, d2gvqd2 automated match to d1o17c1 complexed with be2 |
PDB Entry: 2gvq (more details), 2.43 Å
SCOPe Domain Sequences for d2gvqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvqc1 a.46.2.1 (C:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]} mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar amrelaikid
Timeline for d2gvqc1: