Lineage for d2gvqa1 (2gvq A:1-70)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714352Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2714363Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2714364Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2714365Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 2714373Species Sulfolobus solfataricus [TaxId:2287] [81775] (7 PDB entries)
  8. 2714392Domain d2gvqa1: 2gvq A:1-70 [135783]
    Other proteins in same PDB: d2gvqa2, d2gvqb2, d2gvqc2, d2gvqd2
    automated match to d1o17a1
    complexed with be2

Details for d2gvqa1

PDB Entry: 2gvq (more details), 2.43 Å

PDB Description: anthranilate phosphoribosyl-transferase (trpd) from s. solfataricus in complex with anthranilate
PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d2gvqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvqa1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

SCOPe Domain Coordinates for d2gvqa1:

Click to download the PDB-style file with coordinates for d2gvqa1.
(The format of our PDB-style files is described here.)

Timeline for d2gvqa1: