SCOPe 2.05: Domain d2gvka1: 2gvk A:8-316

Lineage for d2gvka1 (2gvk A:8-316)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins)
   Pfam PF04261

6. Protein Hypothetical protein BT1219 [143266] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143267] (1 PDB entry)
   Uniprot Q8A8E8 8-316

8. Domain d2gvka1: 2gvk A:8-316 [135782]
   complexed with acy, cl, edo, na, unl

Details for d2gvka1

PDB Entry: 2gvk, 1.6 Å

PDB Description: Crystal structure of a dye-decolorizing peroxidase (DyP) from Bacteroides thetaiotaomicron VPI-5482 at 1.6 A resolution

PDB Compounds: (A:) Heme peroxidase

SCOPe Domain Sequences for d2gvka1:

Sequence; same for both SEQRES and ATOM records:

>d2gvka1 d.58.4.14 (A:8-316) Hypothetical protein BT1219 {Bacteroides thetaiotaomicron [TaxId: 818]}
fgghipqdvagkqgenvifivynltdspdtvdkvkdvcanfsamirsmrnrfpdmqfsct
mgfgadawtrlfpdkgkpkelstfseikgekytavstpgdllfhirakqmglcfefasil
deklkgavvsvdethgfrymdgkaiigfvdgtenpavdenpyhfavigeedadfaggsyv
fvqkyihdmvawnalpveqqekvigrhkfndvelsdeekpgnahnavtnigddlkivran
mpfantskgeygtyfigyastfsttrrmlenmfigspagntdrlldfstaitgtlffvps
ydllgelge

Timeline for d2gvka1:

• d2gvka1 first appeared in SCOP 1.73
  
• d2gvka1 appears in SCOPe 2.04
  
• d2gvka1 appears in SCOPe 2.06
  
• d2gvka1 appears in the current release, SCOPe 2.08