![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins) Pfam PF04261 |
![]() | Protein Hypothetical protein BT1219 [143266] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [143267] (1 PDB entry) Uniprot Q8A8E8 8-316 |
![]() | Domain d2gvka1: 2gvk A:8-316 [135782] complexed with acy, cl, edo, na, unl |
PDB Entry: 2gvk (more details), 1.6 Å
SCOPe Domain Sequences for d2gvka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvka1 d.58.4.14 (A:8-316) Hypothetical protein BT1219 {Bacteroides thetaiotaomicron [TaxId: 818]} fgghipqdvagkqgenvifivynltdspdtvdkvkdvcanfsamirsmrnrfpdmqfsct mgfgadawtrlfpdkgkpkelstfseikgekytavstpgdllfhirakqmglcfefasil deklkgavvsvdethgfrymdgkaiigfvdgtenpavdenpyhfavigeedadfaggsyv fvqkyihdmvawnalpveqqekvigrhkfndvelsdeekpgnahnavtnigddlkivran mpfantskgeygtyfigyastfsttrrmlenmfigspagntdrlldfstaitgtlffvps ydllgelge
Timeline for d2gvka1: