Lineage for d2gvka1 (2gvk A:8-316)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949970Family d.58.4.14: Dyp-type peroxidase-like [143265] (4 proteins)
    Pfam PF04261
  6. 2949980Protein Hypothetical protein BT1219 [143266] (1 species)
  7. 2949981Species Bacteroides thetaiotaomicron [TaxId:818] [143267] (1 PDB entry)
    Uniprot Q8A8E8 8-316
  8. 2949982Domain d2gvka1: 2gvk A:8-316 [135782]
    complexed with acy, cl, edo, na, unl

Details for d2gvka1

PDB Entry: 2gvk (more details), 1.6 Å

PDB Description: Crystal structure of a dye-decolorizing peroxidase (DyP) from Bacteroides thetaiotaomicron VPI-5482 at 1.6 A resolution
PDB Compounds: (A:) Heme peroxidase

SCOPe Domain Sequences for d2gvka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvka1 d.58.4.14 (A:8-316) Hypothetical protein BT1219 {Bacteroides thetaiotaomicron [TaxId: 818]}
fgghipqdvagkqgenvifivynltdspdtvdkvkdvcanfsamirsmrnrfpdmqfsct
mgfgadawtrlfpdkgkpkelstfseikgekytavstpgdllfhirakqmglcfefasil
deklkgavvsvdethgfrymdgkaiigfvdgtenpavdenpyhfavigeedadfaggsyv
fvqkyihdmvawnalpveqqekvigrhkfndvelsdeekpgnahnavtnigddlkivran
mpfantskgeygtyfigyastfsttrrmlenmfigspagntdrlldfstaitgtlffvps
ydllgelge

SCOPe Domain Coordinates for d2gvka1:

Click to download the PDB-style file with coordinates for d2gvka1.
(The format of our PDB-style files is described here.)

Timeline for d2gvka1: