Lineage for d2gvhc1 (2gvh C:7-143)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187709Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2187792Protein Probable acyl-CoA hydrolase AGR_L_2016 [143148] (1 species)
  7. 2187793Species Agrobacterium tumefaciens [TaxId:358] [143149] (1 PDB entry)
    Uniprot Q7CTE6 147-262! Uniprot Q7CTE6 9-143
  8. 2187798Domain d2gvhc1: 2gvh C:7-143 [135780]
    automated match to d2gvha1
    complexed with na

Details for d2gvhc1

PDB Entry: 2gvh (more details), 2.5 Å

PDB Description: crystal structure of acyl-coa hydrolase (15159470) from agrobacterium tumefaciens at 2.65 a resolution
PDB Compounds: (C:) AGR_L_2016p

SCOPe Domain Sequences for d2gvhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvhc1 d.38.1.1 (C:7-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}
iekpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvafiaatrfgrtpfvtascer
idfrqparighiveftarpvkagrrsltvevemvaetiigrqqhtctrgifhmvaipege
daasyvlpellteetpd

SCOPe Domain Coordinates for d2gvhc1:

Click to download the PDB-style file with coordinates for d2gvhc1.
(The format of our PDB-style files is described here.)

Timeline for d2gvhc1: