Lineage for d2gvea_ (2gve A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839349Protein automated matches [190298] (3 species)
    not a true protein
  7. 2839359Species Streptomyces rubiginosus [TaxId:1929] [187248] (20 PDB entries)
  8. 2839379Domain d2gvea_: 2gve A: [135775]
    automated match to d1dxia_
    complexed with co, dod

Details for d2gvea_

PDB Entry: 2gve (more details), 2.2 Å

PDB Description: time-of-flight neutron diffraction structure of d-xylose isomerase
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d2gvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvea_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d2gvea_:

Click to download the PDB-style file with coordinates for d2gvea_.
(The format of our PDB-style files is described here.)

Timeline for d2gvea_: