![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries) Uniprot P04896 39-388 |
![]() | Domain d2gvdc2: 2gvd C:39-65,C:202-382 [135774] Other proteins in same PDB: d2gvda_, d2gvdb_, d2gvdc1 automated match to d1cs4c2 complexed with 128, cl, fkp, gsp, mn has additional subdomain(s) that are not in the common domain |
PDB Entry: 2gvd (more details), 2.9 Å
SCOPe Domain Sequences for d2gvdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvdc2 c.37.1.8 (C:39-65,C:202-382) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg dgrhycyphftcavdtenirrvfndcrdi
Timeline for d2gvdc2: