SCOPe 2.08: Domain d2gvdc1: 2gvd C:88-201

Lineage for d2gvdc1 (2gvd C:88-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)

8. Domain d2gvdc1: 2gvd C:88-201 [135773]
   Other proteins in same PDB: d2gvda_, d2gvdb_, d2gvdc2
   automated match to d1cs4c1
   complexed with 128, cl, fkp, gsp, mn

Details for d2gvdc1

PDB Entry: 2gvd, 2.9 Å

PDB Description: complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with tnp-atp and mn

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOPe Domain Sequences for d2gvdc1:

Sequence; same for both SEQRES and ATOM records:

>d2gvdc1 a.66.1.1 (C:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
katkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppefy
ehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d2gvdc1:

• d2gvdc1 first appeared in SCOP 1.73
  
• d2gvdc1 appears in SCOPe 2.07