Lineage for d2gvdb1 (2gvd B:879-1076)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863614Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 863615Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 863660Protein Type II adenylyl cyclase C2 domain [55075] (1 species)
  7. 863661Species Rat (Rattus norvegicus) [TaxId:10116] [55076] (5 PDB entries)
    Uniprot P26769 879-1077
  8. 863664Domain d2gvdb1: 2gvd B:879-1076 [135772]
    Other proteins in same PDB: d2gvda1, d2gvdc1, d2gvdc2
    automatically matched to d1ab8b_
    complexed with 128, cl, fkp, gsp, mn

Details for d2gvdb1

PDB Entry: 2gvd (more details), 2.9 Å

PDB Description: complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with tnp-atp and mn
PDB Compounds: (B:) Adenylate cyclase type 2

SCOP Domain Sequences for d2gvdb1:

Sequence, based on SEQRES records: (download)

>d2gvdb1 d.58.29.1 (B:879-1076) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvn

Sequence, based on observed residues (ATOM records): (download)

>d2gvdb1 d.58.29.1 (B:879-1076) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvn

SCOP Domain Coordinates for d2gvdb1:

Click to download the PDB-style file with coordinates for d2gvdb1.
(The format of our PDB-style files is described here.)

Timeline for d2gvdb1: